DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and Lmcd1

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001008562.1 Gene:Lmcd1 / 494021 RGDID:1308963 Length:365 Species:Rattus norvegicus


Alignment Length:390 Identity:84/390 - (21%)
Similarity:124/390 - (31%) Gaps:127/390 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 SSDYVCMTANLHRNTAAG-------LATGRAAATGAPAQRTVQEPPIITSSLAMGMATAAPPTTS 413
            |.:..|::::|..:...|       .||..|...|....|..:...:|.::         |..|.
  Rat    53 SQEEHCLSSDLEDDRKIGRLLMDSKYATLTARVKGGDGIRIYKRNRMIMTN---------PIATG 108

  Fly   414 NAPTSAAAAPAAPTSTASLRATPIAMTAPLA---VATSPTPSQGSTAVNAALKPRRGLTKNLLPY 475
            ..||         ..|.:....|..:|..|.   :...|...|..|....||..||.|...|..|
  Rat   109 KDPT---------FDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGALYRRRQLMHQLPIY 164

  Fly   476 SVTPPRPAGPTEAQRK-IEELTRQLEEEIEQSEEHGEYFGICHTCGEKVKGAGQACQAMGNLYHT 539
            ...|.|..|..|.:.| :||..:|.:.|                    ..|.|:.          
  Rat   165 DQDPSRCRGLVENELKAMEEFVKQYKSE--------------------ALGVGEV---------- 199

  Fly   540 NCFICCSCGRALRGKAFYNVHGRVYCEEDYMY---SGFQQTAEK---------------CAICGH 586
                      ||.|:      |.:..||:...   .|.:.||..               |.:|..
  Rat   200 ----------ALPGQ------GGLPKEENKTQEKPEGTETTAPTTNGSLGDPSKEVEYVCELCKG 248

  Fly   587 L------IMEMILQAMGKSYHPGCFRCCVCNECL--------DGVPFTVDVDHKIYCVNDYHRMF 637
            :      ::........|.:||.||.|..|:|.|        ||.|         :|...|....
  Rat   249 VAPADSPVVYADRAGYSKQWHPTCFLCIKCSEPLVDLIYFWKDGAP---------WCGRHYCESL 304

  Fly   638 APKCASCGKGITPVEGTDETVRVVSMDKDFHVDCYICEECGMQLTDEPDKRCYPL-DGRLLCRGC 701
            .|:|:.|.:.|.    :::..||  .|..:|...:|||.|...|:.    |.|.: .|:|||..|
  Rat   305 RPRCSGCDEIIF----SEDYQRV--EDLAWHRKHFICEGCEQLLSG----RAYIITKGQLLCPTC 359

  Fly   702  701
              Rat   360  359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 8/52 (15%)
LIM2_Ajuba_like 581..633 CDD:188741 15/65 (23%)
LIM3_Ajuba_like 641..702 CDD:188822 19/62 (31%)
Lmcd1NP_001008562.1 PET_testin 116..203 CDD:193604 26/126 (21%)
LIM1_Testin_like 243..300 CDD:188726 15/65 (23%)
LIM 306..359 CDD:413332 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.