DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and fhl3

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001008165.1 Gene:fhl3 / 493527 XenbaseID:XB-GENE-947662 Length:279 Species:Xenopus tropicalis


Alignment Length:211 Identity:59/211 - (27%)
Similarity:91/211 - (43%) Gaps:13/211 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 EELTRQLEEEIEQSEEHGEYFGICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFY 557
            |..|.|.||.:.......|:...|.:|.:.|....:..:..|..:|.:||||.||.:.:..::|.
 Frog    78 EPFTCQDEELLCNDCYCNEFSSKCISCEKTVMPGSRKLEYNGQTWHEHCFICNSCQQPIGSRSFI 142

  Fly   558 NVHGRVYCEEDYMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVD 622
            ..:...||...|.    .:.|.:|..|...:.:..:....:.:|..||.|..|...|.|..|| .
 Frog   143 PENQNHYCIPCYE----SKLAPRCTHCKKSLTKGGVTYRDEPWHKECFVCTGCKTQLAGQQFT-S 202

  Fly   623 VDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSM-DKDFHVDCYICEECGMQLTDEPD 686
            .|.|.||:..:..::|.|||.|.|.||...|    .:.||. ::.:|..|:.|..|...|.   .
 Frog   203 QDEKPYCIKCFGNLYAKKCAGCTKPITGFGG----AKYVSFEERHWHHSCFNCSRCSTSLV---G 260

  Fly   687 KRCYPLDGRLLCRGCH 702
            |...|.:..:|||.|:
 Frog   261 KGFIPDNEDILCRACN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 14/52 (27%)
LIM2_Ajuba_like 581..633 CDD:188741 15/51 (29%)
LIM3_Ajuba_like 641..702 CDD:188822 19/61 (31%)
fhl3NP_001008165.1 LIM <5..33 CDD:351770
LIM1_FHL3 36..94 CDD:188807 5/15 (33%)
LIM2_FHL3 98..155 CDD:188811 14/56 (25%)
LIM3_FHL 162..213 CDD:188732 15/51 (29%)
LIM4_FHL3 221..276 CDD:188818 19/61 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.