Sequence 1: | NP_572930.3 | Gene: | jub / 32351 | FlyBaseID: | FBgn0030530 | Length: | 728 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004112.1 | Gene: | fhl5 / 445475 | ZFINID: | ZDB-GENE-040822-3 | Length: | 280 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 52/202 - (25%) |
---|---|---|---|
Similarity: | 84/202 - (41%) | Gaps: | 33/202 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 511 EYFGICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYC----EEDYMY 571
Fly 572 SGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRM 636
Fly 637 FAPKCASCGKGITPVEGTDETVRVVSM-DKDFHVDCYICEECGMQ------LTDEPDKRCYPLDG 694
Fly 695 RLLCRGC 701 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jub | NP_572930.3 | LIM1_Ajuba_like | 516..569 | CDD:188738 | 15/56 (27%) |
LIM2_Ajuba_like | 581..633 | CDD:188741 | 15/51 (29%) | ||
LIM3_Ajuba_like | 641..702 | CDD:188822 | 17/68 (25%) | ||
fhl5 | NP_001004112.1 | LIM | <6..34 | CDD:295319 | |
LIM1_FHL | 37..95 | CDD:188729 | |||
LIM | 102..158 | CDD:295319 | 15/55 (27%) | ||
LIM3_FHL | 163..214 | CDD:188732 | 15/51 (29%) | ||
LIM4_FHL | 222..277 | CDD:188733 | 17/68 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |