Sequence 1: | NP_572930.3 | Gene: | jub / 32351 | FlyBaseID: | FBgn0030530 | Length: | 728 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_731242.1 | Gene: | stck / 40999 | FlyBaseID: | FBgn0020249 | Length: | 348 | Species: | Drosophila melanogaster |
Alignment Length: | 267 | Identity: | 63/267 - (23%) |
---|---|---|---|
Similarity: | 101/267 - (37%) | Gaps: | 95/267 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 516 CHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDY--MYSGFQQTA 578
Fly 579 EKCAICGHLIMEMILQAMGKSYHPGCFRC------------------CVCNEC------------ 613
Fly 614 --------LDGVP--FTVDVDH--------------------------------KIYCVNDYHRM 636
Fly 637 FAPKCASCGKGITPVEGTDETVRVVSMDKDFHVDCYICEECGMQLTDEP--DKRCYPLDGRLLCR 699
Fly 700 GCHLQRL 706 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jub | NP_572930.3 | LIM1_Ajuba_like | 516..569 | CDD:188738 | 18/52 (35%) |
LIM2_Ajuba_like | 581..633 | CDD:188741 | 22/123 (18%) | ||
LIM3_Ajuba_like | 641..702 | CDD:188822 | 17/62 (27%) | ||
stck | NP_731242.1 | LIM1_PINCH | 21..79 | CDD:188717 | 19/63 (30%) |
LIM2_PINCH | 82..133 | CDD:188718 | 14/50 (28%) | ||
LIM3_PINCH | 146..206 | CDD:188719 | 7/59 (12%) | ||
LIM4_PINCH | 212..265 | CDD:188720 | 18/65 (28%) | ||
LIM5_PINCH | 273..326 | CDD:188721 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |