DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and fhl1a

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001007288.1 Gene:fhl1a / 399646 ZFINID:ZDB-GENE-040206-1 Length:297 Species:Danio rerio


Alignment Length:221 Identity:56/221 - (25%)
Similarity:93/221 - (42%) Gaps:32/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 RQLEEEIEQSEEHGEYFGICHTCGEKVKGAGQACQA--------------MGNLYHTNCFICCSC 547
            :.|..|..|:::.|:.  :|..||:  :.....||.              ...::|..||.|..|
Zfish    89 KPLANEPFQAKDDGKI--MCGKCGD--RDGSPRCQGCYKVITPGCKNVEYKHKVWHEECFTCFEC 149

  Fly   548 GRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNE 612
            .:.:|.::|......:||...:.    ::.|:.|..|...|....|....:.:|..||.|..|.:
Zfish   150 KQPIRTQSFLTKGDDMYCTPCHE----KKFAKHCVRCKEAITSGGLTYQDQPWHSECFVCHTCKK 210

  Fly   613 CLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSM-DKDFHVDCYICEE 676
            .|.|..||...| :.|||:.|....|.||:.|.   .|:.|......||:. ||.:|..|:.|::
Zfish   211 PLAGARFTAHED-QFYCVDCYKSDVAKKCSGCQ---NPITGFGRGTNVVNYEDKSWHEYCFNCKK 271

  Fly   677 CGMQLTDEPDKRCYPLDGR-LLCRGC 701
            |.:.:.   .|| :.::|. :.|..|
Zfish   272 CSLSMA---HKR-FVINGEDIYCSDC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 14/66 (21%)
LIM2_Ajuba_like 581..633 CDD:188741 17/51 (33%)
LIM3_Ajuba_like 641..702 CDD:188822 17/63 (27%)
fhl1aNP_001007288.1 LIM <21..49 CDD:295319
LIM1_FHL1 56..110 CDD:188730 5/22 (23%)
LIM2_FHL1 118..175 CDD:188808 11/60 (18%)
LIM3_FHL1 179..231 CDD:188813 17/52 (33%)
LIM4_FHL1 234..297 CDD:188734 19/67 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.