DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and fhl1b

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_954687.1 Gene:fhl1b / 387528 ZFINID:ZDB-GENE-031219-1 Length:280 Species:Danio rerio


Alignment Length:187 Identity:53/187 - (28%)
Similarity:85/187 - (45%) Gaps:12/187 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 CHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEK 580
            ||.|.:.:....:..:..||.:|..||.|..|.:.:..|:|...:..|||...:.    ::.|::
Zfish   101 CHGCYKPILPGTENVEYKGNSWHDECFKCYQCQKPIGNKSFITKNNNVYCSPCHE----KKFAKQ 161

  Fly   581 CAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCG 645
            ||.|...|....:....:.:|..||.|..|.:.|.|..|| ..:.|:|||:.|....|.||:.|.
Zfish   162 CACCKKPITTGGVNYQDQPWHSECFVCSSCRKPLAGTRFT-SHEEKVYCVDCYKSTVAKKCSGCQ 225

  Fly   646 KGITPVEGTDETVRVVSMD-KDFHVDCYICEECGMQLTDEPDKRCYPLDGRLLCRGC 701
               .|:.|..:...||:.: ..:|..|:.|::|.:.|.   |||.....|.:.|..|
Zfish   226 ---NPITGFGKATNVVNYEGGSWHDYCFNCKKCSLNLA---DKRFVAHSGHIYCSDC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 15/52 (29%)
LIM2_Ajuba_like 581..633 CDD:188741 17/51 (33%)
LIM3_Ajuba_like 641..702 CDD:188822 17/62 (27%)
fhl1bNP_954687.1 LIM1_FHL1 40..93 CDD:188730
LIM2_FHL1 101..158 CDD:188808 15/60 (25%)
LIM3_FHL1 162..214 CDD:188813 17/52 (33%)
LIM4_FHL1 217..280 CDD:188734 19/66 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.