DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and Prickle4

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001277266.1 Gene:Prickle4 / 381104 MGIID:2685785 Length:369 Species:Mus musculus


Alignment Length:310 Identity:65/310 - (20%)
Similarity:102/310 - (32%) Gaps:85/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 EPPIITSSLAMGMATAAPPTTSNAPTSAAAAPAAPTSTASLRATPIAMTAPLAVATSPTPSQGS- 455
            :||:.|.|     .:...|......|||.||..:......|....::............|.|.| 
Mouse    21 DPPVYTDS-----DSGRRPVEDYEDTSAQAATCSSLGPPCLDINQVSNWPGFRTLLQQLPPQDSD 80

  Fly   456 --------------TAVNAALKPRRGLTKNLLPYSVTPPRPAGPTEAQRKIEELTRQLEEEIEQS 506
                          ..:..|.:.::.|.:.:.  .:.||:..|.|  .:|.::|.          
Mouse    81 ERYCLALGEEELAQLRLFCAQRKQKSLGQGVA--RLLPPKLEGYT--CKKCKKLL---------- 131

  Fly   507 EEHGEYFGICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMY 571
             :.|||.......||      |:|      :|..||.|.:||:.|....::...|.:||...:. 
Mouse   132 -DPGEYGVFAARAGE------QSC------WHRPCFACQACGQGLINLIYFYHEGHLYCGRHHA- 182

  Fly   572 SGFQQTAEKCAICGHLIM-EMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHR 635
               :....:|..|..||. :...:|.|:.:|...|.|..|...|||..:.:...           
Mouse   183 ---ELLRPRCPACDQLIFSQRCTEAEGQRWHENHFCCQDCAGPLDGGRYALPGG----------- 233

  Fly   636 MFAPKCASC-----------------GKGITPVEGTDETV---RVVSMDK 665
              :|.|.||                 |:.....||.|.:|   |..|.||
Mouse   234 --SPCCPSCFSKRYRSAGSSSVGVAEGQASFEEEGPDPSVGWNRASSDDK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 14/52 (27%)
LIM2_Ajuba_like 581..633 CDD:188741 13/52 (25%)
LIM3_Ajuba_like 641..702 CDD:188822 12/45 (27%)
Prickle4NP_001277266.1 PET_OEBT 1..116 CDD:193603 16/101 (16%)
LIM1_Testin_like 124..181 CDD:188726 19/79 (24%)
LIM2_Testin_like 187..241 CDD:188727 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.