DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and prickle1a

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_899185.2 Gene:prickle1a / 368249 ZFINID:ZDB-GENE-030724-5 Length:793 Species:Danio rerio


Alignment Length:227 Identity:57/227 - (25%)
Similarity:92/227 - (40%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 QRKIEELTRQLEEEIEQSEEHGEYFGICHTCGEKVKGAGQA-----CQAMGNLYHTNCFICCSCG 548
            |||.|.|.|...:.:.::..|    ..|..|||::.|...|     ..|.|..:|..||.|.:|.
Zfish   109 QRKKEALGRGTLKILPRTVHH----AACEHCGERLSGGEMAVCVSRAAAAGQCWHPACFTCSTCS 169

  Fly   549 RALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIM-EMILQAMGKSYHPGCFRCCVCNE 612
            ..|....::...|:|:|...:.    :....:|:.|..:|. :...:|.|:.:|...|.|..|..
Zfish   170 ELLVDLIYFYHDGKVHCGRHHA----ELLKPRCSSCDEIIFADECTEAEGRHWHMKHFSCSECEV 230

  Fly   613 CLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKD---FHVD--CY 672
            .|.|..:.:. |.:.:|...:..::|..|.:|.:.|    |.|.    ..|..|   :|..  |:
Zfish   231 ILGGQRYIMK-DGRPFCCGCFQSLYAEYCQACAQHI----GVDH----AQMTYDGLHWHATDACF 286

  Fly   673 ICEECGMQLTDEPDKRCYPLDGRLLC-RGCHL 703
            .|.:|...|...|   ..|..||:.| :.|.|
Zfish   287 SCAQCKSSLLGCP---FLPRQGRIYCSKACSL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 17/57 (30%)
LIM2_Ajuba_like 581..633 CDD:188741 13/52 (25%)
LIM3_Ajuba_like 641..702 CDD:188822 17/66 (26%)
prickle1aNP_899185.2 PET_Prickle 28..124 CDD:193602 6/14 (43%)
LIM1_Prickle 132..191 CDD:188799 17/58 (29%)
LIM2_Prickle 196..251 CDD:188802 13/55 (24%)
LIM3_Prickle 256..314 CDD:188804 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.