DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and Prickle1

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_955428.1 Gene:Prickle1 / 315259 RGDID:735090 Length:831 Species:Rattus norvegicus


Alignment Length:224 Identity:54/224 - (24%)
Similarity:97/224 - (43%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 AQRKIEELTRQLEEEIEQSEEHGEYFGICHTCGEKVKGAGQACQAM----GNLYHTNCFICCSCG 548
            ||||.|.|.|...:.:.::..|    .:|..||.::.|...|..|.    |..:|.:||:|.:|.
  Rat   102 AQRKKEALGRGTIKLLSRAMMH----AVCEQCGLQMNGGEVAVFASRAGPGVCWHPSCFVCFTCN 162

  Fly   549 RALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIM-EMILQAMGKSYHPGCFRCCVCNE 612
            ..|....::...|:::|...:.    :....:|:.|..:|. :...:|.|:.:|...|.|..|..
  Rat   163 ELLVDLIYFYQDGKIHCGRHHA----ELLKPRCSACDEIIFADECTEAEGRHWHMKHFCCLECET 223

  Fly   613 CLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKDFHVD--CYICE 675
            .|.|..:.:. |.:.:|...:..::|..|.:||:.|    |.|. .::....:.:|..  |:.|.
  Rat   224 VLGGQRYIMK-DGRPFCCGCFESLYAEYCETCGEHI----GVDH-AQMTYDGQHWHATEACFSCA 282

  Fly   676 ECGMQLTDEPDKRCYPLDGRLLC-RGCHL 703
            :|...|...|   ..|..|::.| :.|.|
  Rat   283 QCKASLLGCP---FLPKQGQIYCSKTCSL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 15/56 (27%)
LIM2_Ajuba_like 581..633 CDD:188741 13/52 (25%)
LIM3_Ajuba_like 641..702 CDD:188822 15/63 (24%)
Prickle1NP_955428.1 PET_Prickle 22..118 CDD:193602 7/15 (47%)
LIM1_Prickle_1 126..184 CDD:188867 15/57 (26%)
LIM2_Prickle 189..244 CDD:188802 13/55 (24%)
LIM3_Prickle 249..307 CDD:188804 15/65 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..346
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 664..688
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 763..831
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.