DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and Fhl3

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001101449.1 Gene:Fhl3 / 313582 RGDID:1307180 Length:288 Species:Rattus norvegicus


Alignment Length:194 Identity:57/194 - (29%)
Similarity:86/194 - (44%) Gaps:19/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 CHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEK 580
            |..|||.|....:..:..|..:|.:||:|..|.:.|..::|....|..||...|.    .:.|.:
  Rat   101 CSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYE----NKFAPR 161

  Fly   581 CAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCG 645
            ||.|...:.:..:....:.:|..|..|..|...|.|..|| ..|...|||..:..:|||||:||.
  Rat   162 CARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFT-SRDDDPYCVACFGELFAPKCSSCK 225

  Fly   646 KGITPVEGTDET----VRVVSM-DKDFHVDCYICEECGMQLTDE---PDKRCYPLDGRLLCRGC 701
            :.||...|::..    .:.||. |:.:|..|:.|..|...|..:   ||      ..::||:||
  Rat   226 RPITGGSGSEGAGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPD------GDQVLCQGC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 16/52 (31%)
LIM2_Ajuba_like 581..633 CDD:188741 15/51 (29%)
LIM3_Ajuba_like 641..702 CDD:188822 20/69 (29%)
Fhl3NP_001101449.1 LIM <5..33 CDD:413332
LIM1_FHL3 36..94 CDD:188807
LIM2_FHL3 98..155 CDD:188811 16/53 (30%)
LIM3_FHL 162..213 CDD:188732 15/51 (29%)
LIM 221..284 CDD:413332 20/69 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.