Sequence 1: | NP_572930.3 | Gene: | jub / 32351 | FlyBaseID: | FBgn0030530 | Length: | 728 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037529.3 | Gene: | PRICKLE4 / 29964 | HGNCID: | 16805 | Length: | 384 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 47/206 - (22%) |
---|---|---|---|
Similarity: | 72/206 - (34%) | Gaps: | 65/206 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 488 AQRKIEELTR--------QLE----EEIEQSEEHGEYFGICHTCGEKVKGAGQACQAMGNLYHTN 540
Fly 541 CFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIME-MILQAMGKSYHPGC 604
Fly 605 FRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGK----------------------- 646
Fly 647 GITPVEGTDET 657 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jub | NP_572930.3 | LIM1_Ajuba_like | 516..569 | CDD:188738 | 15/52 (29%) |
LIM2_Ajuba_like | 581..633 | CDD:188741 | 12/52 (23%) | ||
LIM3_Ajuba_like | 641..702 | CDD:188822 | 8/40 (20%) | ||
PRICKLE4 | NP_037529.3 | PET_OEBT | 1..116 | CDD:193603 | 5/15 (33%) |
LIM1_Testin_like | 124..181 | CDD:188726 | 19/68 (28%) | ||
LIM2_Testin_like | 187..242 | CDD:188727 | 16/67 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |