DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and PRICKLE4

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_037529.3 Gene:PRICKLE4 / 29964 HGNCID:16805 Length:384 Species:Homo sapiens


Alignment Length:206 Identity:47/206 - (22%)
Similarity:72/206 - (34%) Gaps:65/206 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 AQRKIEELTR--------QLE----EEIEQSEEHGEYFGICHTCGEKVKGAGQACQAMGNLYHTN 540
            |:||.|.|.:        :||    |:..:..:.|||.......||      |.|      :|..
Human   100 ARRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGE------QRC------WHQP 152

  Fly   541 CFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIME-MILQAMGKSYHPGC 604
            ||.|.:||:||....::...|::||...:.    :....:|..|..||.. ...:|.|:.:|...
Human   153 CFACQACGQALINLIYFYHDGQLYCGRHHA----ELLRPRCPACDQLIFSWRCTEAEGQRWHENH 213

  Fly   605 FRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGK----------------------- 646
            |.|..|...|.|..:.:...             :|.|.||.:                       
Human   214 FCCQDCAGPLGGGRYALPGG-------------SPCCPSCFENRYSDAGSSWAGALEGQAFLGET 265

  Fly   647 GITPVEGTDET 657
            |:...||.|:|
Human   266 GLDRTEGRDQT 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 15/52 (29%)
LIM2_Ajuba_like 581..633 CDD:188741 12/52 (23%)
LIM3_Ajuba_like 641..702 CDD:188822 8/40 (20%)
PRICKLE4NP_037529.3 PET_OEBT 1..116 CDD:193603 5/15 (33%)
LIM1_Testin_like 124..181 CDD:188726 19/68 (28%)
LIM2_Testin_like 187..242 CDD:188727 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.