DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and Prickle2

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_006506169.1 Gene:Prickle2 / 243548 MGIID:1925144 Length:937 Species:Mus musculus


Alignment Length:295 Identity:69/295 - (23%)
Similarity:112/295 - (37%) Gaps:75/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 VNAALKPRR------GLTKNLLPYSVTPPRPAGPTEAQRKIEELTRQL--------------EEE 502
            |...|||.:      .|.:..:||    ...||   .:.:|::|..||              |||
Mouse   132 VPPGLKPEQVHQYYSCLPEEKVPY----VNSAG---EKLRIKQLLHQLPPHDNEVRYCNSLDEEE 189

  Fly   503 -----IEQSEEHGEYFG--------------ICHTCGEKVKGAGQACQAM----GNLYHTNCFIC 544
                 :..::...|..|              ||..||.::||...|..|.    |..:|..||:|
Mouse   190 KRELKLFSNQRKRENLGRGNVRPFPVTMTGAICEQCGGQIKGGDIAVFASRAGHGICWHPPCFVC 254

  Fly   545 CSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAE----KCAICGHLIM-EMILQAMGKSYHPGC 604
            ..|...|....::...|::||...:        ||    :||.|..:|. :...:|.|:.:|...
Mouse   255 TVCNELLVDLIYFYQDGKIYCGRHH--------AECLKPRCAACDEIIFADECTEAEGRHWHMRH 311

  Fly   605 FRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKDFHV 669
            |.|..|...|.|..:.:. :.:.||.:.:..::|..|.:|.:.|    |.|:. ::....:.:|.
Mouse   312 FCCFECETVLGGQRYIMK-EGRPYCCHCFESLYAEYCDTCAQHI----GIDQG-QMTYDGQHWHA 370

  Fly   670 --DCYICEECGMQLTDEPDKRCYPLDGRLLC-RGC 701
              .|:.|..|...|...|   ..|..|::.| |.|
Mouse   371 TETCFCCAHCKKSLLGRP---FLPKQGQIFCSRAC 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 17/56 (30%)
LIM2_Ajuba_like 581..633 CDD:188741 14/52 (27%)
LIM3_Ajuba_like 641..702 CDD:188822 16/64 (25%)
Prickle2XP_006506169.1 PET_Prickle 118..214 CDD:193602 18/88 (20%)
LIM1_Prickle 222..280 CDD:188799 17/65 (26%)
LIM2_Prickle 285..340 CDD:188802 14/55 (25%)
LIM3_Prickle 345..403 CDD:188804 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.