DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and FHL2

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001034581.1 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens


Alignment Length:197 Identity:52/197 - (26%)
Similarity:84/197 - (42%) Gaps:23/197 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 EYFGICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQ 575
            ||...|..|.:.:....:..:..|:.:|..||||..|.:.:..|:|.....:.:|...|.    :
Human    96 EYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYE----K 156

  Fly   576 QTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPK 640
            |.|.:|..|...|....:....:.:|..||.|..|.:.|.|..||.. |...||:|.:..::|.|
Human   157 QHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTAR-DDFAYCLNCFCDLYAKK 220

  Fly   641 CASCGKGITPVEGTDETVRVVSMDKDFHVDCYICEECGMQ------LTDEPDKRCYPLDGRLLCR 699
            ||.|   ..|:.|...|..:...::.:|.||:.|::|.:.      ||:..|         :||.
Human   221 CAGC---TNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDD---------ILCP 273

  Fly   700 GC 701
            .|
Human   274 DC 275

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 12/52 (23%)
LIM2_Ajuba_like 581..633 CDD:188741 16/51 (31%)
LIM3_Ajuba_like 641..702 CDD:188822 17/67 (25%)
FHL2NP_001034581.1 LIM <5..33 CDD:413332