DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and Fhl1

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_006527864.1 Gene:Fhl1 / 14199 MGIID:1298387 Length:339 Species:Mus musculus


Alignment Length:253 Identity:60/253 - (23%)
Similarity:94/253 - (37%) Gaps:57/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 CHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEK 580
            |..|.:.:....:........:|.|||.|..|...|..:.|.:..|::.|.:    ...::.:.:
Mouse    56 CVDCRKPISADAKEVHYKNRYWHDNCFRCAKCLHPLASETFVSKDGKILCNK----CATREDSPR 116

  Fly   581 CAICGHLIM--EMILQAMGKSYHPGCFRCCVCNECL-DGVPFTVDVDHKIYCVNDYHRMFAPKCA 642
            |..|...|:  :..::..|..:|..||.|..|.:.: .|..|....|  .|||..:...||..|.
Mouse   117 CKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGED--FYCVTCHETKFAKHCV 179

  Fly   643 SCGKGITPVEGTDETVRVVSMDKDFHVDCYICEEC-----GMQLTDEPDK----RCY-------- 690
            .|.|.||       :..:...|:.:|.:|::|..|     |.:.|...|:    .||        
Mouse   180 KCNKAIT-------SGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKC 237

  Fly   691 -----PLDG-RLLCR------------GCHLQRLALQSSPHA----RHQ--EPVCASY 724
                 |:.| |.:.|            .||.:||.|...|.|    ||.  |..|.|:
Mouse   238 AGCKNPITGKRTVSRVSHPVSKARKSPVCHGKRLPLTLFPSANLRGRHPGGERTCPSW 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 12/52 (23%)
LIM2_Ajuba_like 581..633 CDD:188741 15/54 (28%)
LIM3_Ajuba_like 641..702 CDD:188822 19/95 (20%)
Fhl1XP_006527864.1 LIM <21..49 CDD:351770
LIM1_FHL1 56..109 CDD:188730 12/56 (21%)
LIM2_FHL1 117..174 CDD:188808 15/58 (26%)
LIM3_FHL1 178..230 CDD:188813 14/58 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.