Sequence 1: | NP_572930.3 | Gene: | jub / 32351 | FlyBaseID: | FBgn0030530 | Length: | 728 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006527864.1 | Gene: | Fhl1 / 14199 | MGIID: | 1298387 | Length: | 339 | Species: | Mus musculus |
Alignment Length: | 253 | Identity: | 60/253 - (23%) |
---|---|---|---|
Similarity: | 94/253 - (37%) | Gaps: | 57/253 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 516 CHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEK 580
Fly 581 CAICGHLIM--EMILQAMGKSYHPGCFRCCVCNECL-DGVPFTVDVDHKIYCVNDYHRMFAPKCA 642
Fly 643 SCGKGITPVEGTDETVRVVSMDKDFHVDCYICEEC-----GMQLTDEPDK----RCY-------- 690
Fly 691 -----PLDG-RLLCR------------GCHLQRLALQSSPHA----RHQ--EPVCASY 724 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jub | NP_572930.3 | LIM1_Ajuba_like | 516..569 | CDD:188738 | 12/52 (23%) |
LIM2_Ajuba_like | 581..633 | CDD:188741 | 15/54 (28%) | ||
LIM3_Ajuba_like | 641..702 | CDD:188822 | 19/95 (20%) | ||
Fhl1 | XP_006527864.1 | LIM | <21..49 | CDD:351770 | |
LIM1_FHL1 | 56..109 | CDD:188730 | 12/56 (21%) | ||
LIM2_FHL1 | 117..174 | CDD:188808 | 15/58 (26%) | ||
LIM3_FHL1 | 178..230 | CDD:188813 | 14/58 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |