DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and CLIC3

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:231 Identity:62/231 - (26%)
Similarity:103/231 - (44%) Gaps:25/231 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPI 86
            :::|.:|||. ||...|.|..||..||.|.    ||.:...:||||.::.|...:.....:..||
Human     5 KLQLFVKASE-DGESVGHCPSCQRLFMVLL----LKGVPFTLTTVDTRRSPDVLKDFAPGSQLPI 64

  Fly    87 LIDNGLAILENEKIERHIMKNI--PGGYNLFVQDKEVATLIENLYVK----LKLMLVKKDEAKNN 145
            |:.:..|..:..:||..:.:.:  |...:|..:.:|..|...:::.|    :|..:..:|||...
Human    65 LLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQ 129

  Fly   146 ALLSHLRKINDHLSA--------------RNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFE 196
            .||..|.:::.:|.|              ...|||.||.:...||.|:|:|..:.....:|....
Human   130 QLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAP 194

  Fly   197 IPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHYK 232
            ||..|..:.||:....|...|..:||...:|:..|:
Human   195 IPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 27/91 (30%)
O-ClC 21..231 CDD:129941 61/228 (27%)
GST_C_CLIC 118..232 CDD:198307 33/131 (25%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 26/87 (30%)
PLN02817 5..229 CDD:330276 61/228 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4781
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57946
OrthoDB 1 1.010 - - D541338at33208
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm41081
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.