DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and CAM1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:34/152 - (22%)
Similarity:49/152 - (32%) Gaps:61/152 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ETNGSSKFDVPEIELIIKASTI--DGRRK---------GACLFCQEYFMDLYLLAELKTISLKVT 64
            ||..|||.....:||:.|::.:  |.:||         ....|.:.|..:.|.|       .|||
Yeast   246 ETETSSKKPKHPLELLGKSTFVLDDWKRKYSNEDTRPVALPWFWEHYNPEEYSL-------WKVT 303

  Fly    65 TVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLY 129
                      ::.|.|.|         |..:.|         |:.||:            ...|.
Yeast   304 ----------YKYNDELT---------LTFMSN---------NLVGGF------------FNRLS 328

  Fly   130 VKLKLM---LVKKDEAKNNALL 148
            ...|.|   ||...|..||.::
Yeast   329 ASTKYMFGCLVVYGENNNNGIV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 20/104 (19%)
O-ClC 21..231 CDD:129941 29/142 (20%)
GST_C_CLIC 118..232 CDD:198307 8/34 (24%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342
GST_C_EF1Bgamma_like 92..214 CDD:198290
EF1G 255..359 CDD:395522 29/143 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.