DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GTT2

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:40/198 - (20%)
Similarity:71/198 - (35%) Gaps:53/198 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LAELKTI-SLKVTTVDM----QKPPPDFRTNFEATHPPILIDNGLAILENEKIERHI--MKNIP- 109
            |||...: |::...:::    .|.|.....|:..|.|.:.:|:|..|.|...|..:|  :...| 
Yeast    37 LAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTLIAECTAITEYIDALDGTPT 101

  Fly   110 ---------GGYNLFVQDKEVATL-----------------IENLYVKLKLMLVKKDEAKNNALL 148
                     |..::..:..|:..|                 :| ||...:..|.::|:|     |
Yeast   102 LTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHATPGLGPEVE-LYQNKEWGLRQRDKA-----L 160

  Fly   149 SHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYF---VDFEIPTHLTALWRYMYH 210
            ..:...:..|  |...::.||:....|..:        :||..|   |..::|....||..:...
Yeast   161 HGMHYFDTVL--RERPYVAGDSFSMADITV--------IAGLIFAAIVKLQVPEECEALRAWYKR 215

  Fly   211 MYQ 213
            |.|
Yeast   216 MQQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 17/75 (23%)
O-ClC 21..231 CDD:129941 40/198 (20%)
GST_C_CLIC 118..232 CDD:198307 23/116 (20%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 14/56 (25%)
GST_C_GTT2_like 106..222 CDD:198291 24/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.