Sequence 1: | NP_001259537.2 | Gene: | Clic / 32349 | FlyBaseID: | FBgn0030529 | Length: | 260 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_013040.1 | Gene: | GTT2 / 850666 | SGDID: | S000003983 | Length: | 233 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 198 | Identity: | 40/198 - (20%) |
---|---|---|---|
Similarity: | 71/198 - (35%) | Gaps: | 53/198 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 LAELKTI-SLKVTTVDM----QKPPPDFRTNFEATHPPILIDNGLAILENEKIERHI--MKNIP- 109
Fly 110 ---------GGYNLFVQDKEVATL-----------------IENLYVKLKLMLVKKDEAKNNALL 148
Fly 149 SHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYF---VDFEIPTHLTALWRYMYH 210
Fly 211 MYQ 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Clic | NP_001259537.2 | GST_N_CLIC | 18..112 | CDD:239359 | 17/75 (23%) |
O-ClC | 21..231 | CDD:129941 | 40/198 (20%) | ||
GST_C_CLIC | 118..232 | CDD:198307 | 23/116 (20%) | ||
GTT2 | NP_013040.1 | GST_N_GTT2_like | 19..94 | CDD:239349 | 14/56 (25%) |
GST_C_GTT2_like | 106..222 | CDD:198291 | 24/129 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C157345154 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |