DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and DHAR2

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_177662.1 Gene:DHAR2 / 843864 AraportID:AT1G75270 Length:213 Species:Arabidopsis thaliana


Alignment Length:202 Identity:45/202 - (22%)
Similarity:86/202 - (42%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDF-RTNFEATHPPILIDNG--------LA 93
            |.|.|.|...:.|    |.|.:..|...:::...|..| ..:.|...|.:.:|..        :.
plant    18 GDCPFSQRVLLTL----EEKKLPYKTHLINVSDKPQWFLDISPEGKVPVVKLDGKWVADSDVIVG 78

  Fly    94 ILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLMLVKKD--EAKNNALLSHLRKIND 156
            :|| ||.....:|..|          |.|::...::......|..||  :....||:..|..:.:
plant    79 LLE-EKYPEPSLKTPP----------EFASVGSKIFGAFVTFLKSKDANDGSEKALVDELEALEN 132

  Fly   157 HLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSC 221
            ||...:..|:.|:.:...|..|.|:|.|:.||..::.::.:|..||::..|...::..::| ::.
plant   133 HLKTHSGPFVAGEKITAVDLSLAPKLYHLEVALGHYKNWSVPESLTSVRNYAKALFSRESF-ENT 196

  Fly   222 PADQDII 228
            .|.::|:
plant   197 KAKKEIV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 19/82 (23%)
O-ClC 21..231 CDD:129941 45/202 (22%)
GST_C_CLIC 118..232 CDD:198307 26/113 (23%)
DHAR2NP_177662.1 PLN02378 1..212 CDD:166019 45/202 (22%)
GST_N_3 19..88 CDD:290153 16/73 (22%)
GST_C_DHAR 89..210 CDD:198310 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57946
OrthoDB 1 1.010 - - D974249at2759
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.