DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and clic3

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:233 Identity:72/233 - (30%)
Similarity:110/233 - (47%) Gaps:25/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DVPEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATH 83
            :..:|||.:|||. ||...|.|.|||..||.|:    ||.::..:|||||::.|...:.....:.
Zfish     3 EAAKIELFVKASD-DGESVGNCPFCQRLFMILW----LKGVNFTLTTVDMKRAPEVLKDLAPGSQ 62

  Fly    84 PPILIDNGLAILENEKIERHIMKNI-PGGY-NLFVQDKEVATLIENLYVKLKLMLVKKDEAKNNA 146
            ||.||.||....:..|||..:...: |..| .|..:.||..|..::::.|....:...:...|:.
Zfish    63 PPFLIYNGEVRTDTNKIEEFLEDTLAPPQYPKLCCRYKESNTAGDDIFHKFSAYIKNPNPGLNDM 127

  Fly   147 L----LSHLRKI--------------NDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFV 193
            |    |..|.|:              |..||.....:|.|:.:...||.|:|:|..::|..|.:.
Zfish   128 LEKKFLKSLMKLDQYLLTPLPHELDQNPELSTSTRHYLDGNALSLADCNLLPKLHIVKVVCKKYR 192

  Fly   194 DFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHY 231
            .||||..|..|.:|:...|:.|.|..:||.|::|:..|
Zfish   193 GFEIPAELKGLSKYLDKAYKEDVFHLTCPKDKEILLAY 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 34/93 (37%)
O-ClC 21..231 CDD:129941 71/229 (31%)
GST_C_CLIC 118..232 CDD:198307 36/132 (27%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 34/93 (37%)
O-ClC 6..237 CDD:129941 72/230 (31%)
GST_C_CLIC3 99..231 CDD:198332 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D541338at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43920
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.