DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and DHAR1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_173387.1 Gene:DHAR1 / 838544 AraportID:AT1G19570 Length:213 Species:Arabidopsis thaliana


Alignment Length:218 Identity:52/218 - (23%)
Similarity:97/218 - (44%) Gaps:26/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPIL 87
            :|:.:||:.......|.|.|.|...:.|    |.|:::.|:..:::...|..|.........|:|
plant     3 LEICVKAAVGAPDHLGDCPFSQRALLTL----EEKSLTYKIHLINLSDKPQWFLDISPQGKVPVL 63

  Fly    88 -IDNG--------LAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLMLVKKD--E 141
             ||:.        :.||| ||.....:|.          ..|.|::..|::......|..||  :
plant    64 KIDDKWVTDSDVIVGILE-EKYPDPPLKT----------PAEFASVGSNIFGTFGTFLKSKDSND 117

  Fly   142 AKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALWR 206
            ...:|||..|..:.:||.:.:..|:.|:.:...|..|.|:|.|::||..:|..:.:|.....:..
plant   118 GSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHN 182

  Fly   207 YMYHMYQLDAFTQSCPADQDIIN 229
            ||..::.||:|.::...::.:|:
plant   183 YMKTLFSLDSFEKTKTEEKYVIS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 23/97 (24%)
O-ClC 21..231 CDD:129941 52/218 (24%)
GST_C_CLIC 118..232 CDD:198307 29/114 (25%)
DHAR1NP_173387.1 PLN02378 1..213 CDD:166019 52/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57946
OrthoDB 1 1.010 - - D974249at2759
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.