DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Clic and AT1G19550

DIOPT Version :9

Sequence 1:	NP_001259537.2	Gene:	Clic / 32349	FlyBaseID:	FBgn0030529	Length:	260	Species:	Drosophila melanogaster
Sequence 2:	NP_173386.1	Gene:	AT1G19550 / 838542	AraportID:	AT1G19550	Length:	153	Species:	Arabidopsis thaliana

Alignment Length:	76	Identity:	19/76 - (25%)
Similarity:	42/76 - (55%)	Gaps:	0/76 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   154 INDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFT 218
            :.:||.:.:..|:.|:.:...|..|.|:|.|::||..:|..:.:|.....:..||..::.||:|.
plant    70 LENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFE 134

  Fly   219 QSCPADQDIIN 229
            ::...::.:|:
plant   135 KTKTEEKCVIS 145

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Clic	NP_001259537.2	GST_N_CLIC	18..112	CDD:239359
		O-ClC	21..231	CDD:129941	19/76 (25%)
		GST_C_CLIC	118..232	CDD:198307	19/76 (25%)
AT1G19550	NP_173386.1	PLN02378	<9..153	CDD:166019	19/76 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D974249at2759
OrthoFinder	1	1.000	-	-		FOG0000394
OrthoInspector	1	1.000	-	-		otm3083
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	5	4.920