DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and ERD9

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_172508.4 Gene:ERD9 / 837576 AraportID:AT1G10370 Length:227 Species:Arabidopsis thaliana


Alignment Length:202 Identity:42/202 - (20%)
Similarity:71/202 - (35%) Gaps:44/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPP 85
            |.|.|.:|:...:        |.||.|      .....:.||...|. :|.|.....:...:...
plant    20 PRIALNLKSVPYE--------FLQETF------GSKSELLLKSNPVH-KKIPVLLHADKPVSESN 69

  Fly    86 ILID--------NGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLMLVKKDEA 142
            |:::        :|.:||.::..:| .|......|           :.|..:|.|:..|....|.
plant    70 IIVEYIDDTWSSSGPSILPSDPYDR-AMARFWAAY-----------IDEKWFVALRGFLKAGGEE 122

  Fly   143 KNNALLSHLRKINDHLS------ARNTRFLTGDTMCCFDCELMPRLQHIRV---AGKYFVDFEIP 198
            :..|:::.|.:.|..|.      ::...|..||.:...|..|...|..:||   |..|.:..|..
plant   123 EKKAVIAQLEEGNAFLEKAFIDCSKGKPFFNGDNIGYLDIALGCFLAWLRVTELAVSYKILDEAK 187

  Fly   199 THLTALW 205
            |...:.|
plant   188 TPSLSKW 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 19/98 (19%)
O-ClC 21..231 CDD:129941 42/202 (21%)
GST_C_CLIC 118..232 CDD:198307 22/97 (23%)
ERD9NP_172508.4 GST_N_Tau 6..79 CDD:239356 14/73 (19%)
GST_C_Tau 91..221 CDD:198294 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.