DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and AT1G09640

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_563848.1 Gene:AT1G09640 / 837491 AraportID:AT1G09640 Length:414 Species:Arabidopsis thaliana


Alignment Length:244 Identity:52/244 - (21%)
Similarity:89/244 - (36%) Gaps:71/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PPDFR---TN----FEATHP----PILIDNGLAILENEKIERHIMK----NIPGGYNLFVQDKEV 121
            |.||:   ||    |...:|    |:|.....::.|:..|.|::.:    |...|.:| ::..::
plant    31 PSDFQMGVTNKTPAFLKMNPIGKVPVLETPEGSVFESNAIARYVSRLNGDNSLNGSSL-IEYAQI 94

  Fly   122 ATLIENLYVKLKLMLVK--------------KDEAKNNALLSHLRKINDHLSARNTRFLTGDTMC 172
            ...|:...:::...:::              .:|...:.|...|..:|.||:: || :|.|.::.
plant    95 EQWIDFSSLEIYASILRWFGPRMGFMPYSAPAEEGAISTLKRALDALNTHLTS-NT-YLVGHSIT 157

  Fly   173 CFD----CELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAF---------TQSCPAD 224
            ..|    |.|  .|....|..|.|.. |.| |:.   ||.:.:.....|         |::.|. 
plant   158 LADIITVCNL--NLGFATVMTKKFTS-EFP-HVE---RYFWTVVNQPNFTKVLGDVKQTEAVPP- 214

  Fly   225 QDIINHYKLQQSLKMKKH---------------EELETPTFTTYIPIDI 258
               |...|..|..|.|:.               ||.|.|......|:|:
plant   215 ---IASKKAAQPAKPKEEPKKKEAPVAEAPKLAEEEEAPKPKAKNPLDL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 13/54 (24%)
O-ClC 21..231 CDD:129941 42/200 (21%)
GST_C_CLIC 118..232 CDD:198307 27/140 (19%)
AT1G09640NP_563848.1 GST_N_EF1Bgamma 3..77 CDD:239342 12/45 (27%)
GST_C_EF1Bgamma_like 90..210 CDD:198290 24/128 (19%)
EF1G 255..361 CDD:395522 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.