DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GSTL3

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_195899.1 Gene:GSTL3 / 831798 AraportID:AT5G02790 Length:235 Species:Arabidopsis thaliana


Alignment Length:229 Identity:45/229 - (19%)
Similarity:87/229 - (37%) Gaps:46/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 STIDGRRK----GACLFCQEYFMDLYLLAELKTI--SLKVTTVDMQKPPPDFRTNFEATHP---- 84
            |..||..:    ..|.|.|.    :::....|.:  .:|:..:|:...|..::   |..:|    
plant    23 SLFDGTTRLYTSYVCPFAQR----VWITRNFKGLQEKIKLVPLDLGNRPAWYK---EKVYPENKV 80

  Fly    85 PILIDNGLAILENEKIERHIMKNIPGGYNLFVQD-----------KEVATLIENLYVKLKLMLVK 138
            |.|..||..|.|:..:.:: :.|...|.:|:.:|           |...|.::.:||.|     |
plant    81 PALEHNGKIIGESLDLIKY-LDNTFEGPSLYPEDHAKREFGDELLKYTDTFVKTMYVSL-----K 139

  Fly   139 KDEAKNNA-----LLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIP 198
            .|.:|..|     |.:.|.|.:|      ..|..|. :...|...:|.::..:.........:|.
plant   140 GDPSKETAPVLDYLENALYKFDD------GPFFLGQ-LSLVDIAYIPFIERFQTVLNELFKCDIT 197

  Fly   199 THLTALWRYMYHMYQLDAFTQSCPADQDIINHYK 232
            .....|..::..:.:.|.:.|:....::|:..:|
plant   198 AERPKLSAWIEEINKSDGYAQTKMDPKEIVEVFK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 19/91 (21%)
O-ClC 21..231 CDD:129941 44/226 (19%)
GST_C_CLIC 118..232 CDD:198307 23/129 (18%)
GSTL3NP_195899.1 GstA 31..210 CDD:223698 38/198 (19%)
GST_N_3 31..108 CDD:290153 17/84 (20%)
GST_C_Lambda 113..231 CDD:198312 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.