DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and DHAR3

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_568336.1 Gene:DHAR3 / 831532 AraportID:AT5G16710 Length:258 Species:Arabidopsis thaliana


Alignment Length:215 Identity:51/215 - (23%)
Similarity:97/215 - (45%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDF-RTNFEATHPPI 86
            :|:.:|||.....:.|.|.|||:    :.|..|.|.:...:..||:...|..| :.:.|...|.:
plant    49 LEICVKASITTPNKLGDCPFCQK----VLLTMEEKNVPYDMKMVDLSNKPEWFLKISPEGKVPVV 109

  Fly    87 LIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKL------MLVKKD--EAK 143
            ..|... :.:::.|.:.:.:..|        :..:||..|...|..|:      .|..||  :..
plant   110 KFDEKW-VPDSDVITQALEEKYP--------EPPLATPPEKASVGSKIFSTFVGFLKSKDSGDGT 165

  Fly   144 NNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALWRYM 208
            ...||..|...||::. .|..|:.|:.:...|..|.|:|.|:::|..::.::.:|..|..:..||
plant   166 EQVLLDELTTFNDYIK-DNGPFINGEKISAADLSLAPKLYHMKIALGHYKNWSVPDSLPFVKSYM 229

  Fly   209 YHMYQLDAFTQSCPADQDII 228
            .:::..::||.:....:|:|
plant   230 ENVFSRESFTNTRAETEDVI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 21/89 (24%)
O-ClC 21..231 CDD:129941 51/215 (24%)
GST_C_CLIC 118..232 CDD:198307 30/119 (25%)
DHAR3NP_568336.1 PLN02817 3..258 CDD:166458 51/215 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57946
OrthoDB 1 1.010 - - D974249at2759
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.