DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GSTU5

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_180506.1 Gene:GSTU5 / 817494 AraportID:AT2G29450 Length:224 Species:Arabidopsis thaliana


Alignment Length:100 Identity:21/100 - (21%)
Similarity:40/100 - (40%) Gaps:19/100 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PILIDNGLAILENEKIERHIMKNIPGGYNLFVQD-------KEVATLIENLYVKLK-LMLVKKDE 141
            |:|:.||..|||:..|..:|.:..|.. .:..||       :..|.|::...:.:. :.:.:.||
plant    57 PVLVHNGKTILESHVILEYIDETWPQN-PILPQDPYERSKARFFAKLVDEQIMNVGFISMARADE 120

  Fly   142 AKNNALLSHLRKI----------NDHLSARNTRFL 166
            .....|...:|::          .|:...:...||
plant   121 KGREVLAEQVRELIMYLEKELVGKDYFGGKTVGFL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 10/26 (38%)
O-ClC 21..231 CDD:129941 20/99 (20%)
GST_C_CLIC 118..232 CDD:198307 9/66 (14%)
GSTU5NP_180506.1 GST_N_Tau 7..80 CDD:239356 9/22 (41%)
GstA 8..195 CDD:223698 20/99 (20%)
GST_C_Tau 90..217 CDD:198294 8/65 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.