DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and Gstt4

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus


Alignment Length:197 Identity:37/197 - (18%)
Similarity:70/197 - (35%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EYFMDL--------YLLAELKTISLKVTTVDMQKPPPDFRTNFEATHP----PILIDNGLAILEN 97
            |.:|||        |:.|....|......||:.|.....:...| .:|    |.|.|....:.|:
Mouse     4 ELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIE-INPLRKLPSLKDGKFILSES 67

  Fly    98 EKIERHIMKNIPGGYNLFVQDKEVATLIEN----------------LYVKLKLMLVKKDEAKNNA 146
            ..|..::.:......:.:..|..:...::.                |::||.:.::..:|.....
Mouse    68 VAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTER 132

  Fly   147 LLSHLRKINDHLS------ARNTRFLTGDTMCCFD-CELMPRLQHIRVAGKYFVDFEIPTHLTAL 204
            |...|.::..:|.      .::..|:|||.:...| ..|:..:|.:......||..::     |.
Mouse   133 LEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVALVEMMQPMGSNHNVFVSSKL-----AE 192

  Fly   205 WR 206
            ||
Mouse   193 WR 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 17/78 (22%)
O-ClC 21..231 CDD:129941 37/197 (19%)
GST_C_CLIC 118..232 CDD:198307 20/112 (18%)
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 30/166 (18%)
GST_N_Theta 3..78 CDD:239348 17/74 (23%)