DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and Clic3

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:220 Identity:57/220 - (25%)
Similarity:92/220 - (41%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILEN 97
            ||...|.|..||..||.|.    ||.:...:||||.::.....:.....:..|||:.:|....:.
Mouse    47 DGESVGHCPSCQRLFMVLL----LKGVPFTLTTVDTRRALDVLKDFAPGSQLPILLYDGDVKTDT 107

  Fly    98 EKIERHIMKNI--PGGYNLFVQDKEVATLIENLYVKLKLMLVKKDEAKNNALL-----------S 149
            .:||..:.:.:  |...:|..:.:|..|...:::.|....:......::|||.           |
Mouse   108 LQIEEFLEETLGPPDFPSLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDNALYQQLLRALTRLDS 172

  Fly   150 HLRKIND-------HLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALWRY 207
            :||...|       ||...:.|||.||.....||.|:|:|..:.....:|....||..|:.:.||
Mouse   173 YLRAPLDHELAQEPHLRESHRRFLDGDQFTLADCSLLPKLHIVDTVCAHFRQLPIPAELSCVRRY 237

  Fly   208 MYHMYQLDAFTQSCPADQDIINHYK 232
            :....|...|..:||...:|:..|:
Mouse   238 LDSALQKKEFKYTCPHSAEILAAYQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 22/80 (28%)
O-ClC 21..231 CDD:129941 56/217 (26%)
GST_C_CLIC 118..232 CDD:198307 33/131 (25%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 56/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4746
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57946
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm43152
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.