DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and Gstt4

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:197 Identity:37/197 - (18%)
Similarity:70/197 - (35%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EYFMDL--------YLLAELKTISLKVTTVDMQKPPPDFRTNFEATHP----PILIDNGLAILEN 97
            |.:|||        |:.|....|......||:.|.....:...| .:|    |.|.|....:.|:
  Rat     4 ELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIE-INPLRKVPSLRDGKFILSES 67

  Fly    98 EKIERHIMKNIPGGYNLFVQDKEVATLIEN----------------LYVKLKLMLVKKDEAKNNA 146
            ..|..::.:......:.:..|..:...::.                |::||.:.::..:|.....
  Rat    68 VAILCYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTER 132

  Fly   147 LLSHLRKINDHLSARNTRFL------TGDTMCCFD-CELMPRLQHIRVAGKYFVDFEIPTHLTAL 204
            |...|.::|.::.....:||      |||.:...| ..|:..:|.:......|:..::     |.
  Rat   133 LDKTLDEVNKNIKQFEEKFLQDKLFITGDHISLADLVALVEMMQPMGTNHNVFISSKL-----AE 192

  Fly   205 WR 206
            ||
  Rat   193 WR 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 17/78 (22%)
O-ClC 21..231 CDD:129941 37/197 (19%)
GST_C_CLIC 118..232 CDD:198307 20/112 (18%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 17/74 (23%)