DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and gstr

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:178 Identity:33/178 - (18%)
Similarity:61/178 - (34%) Gaps:55/178 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPD----------- 74
            ||::.:...:.:...:.|..:..:.:...|||.:..|:...::.        ||           
Zfish    46 PEVKALNPRAQLPTFKHGEIVVNESFAACLYLESVFKSQGTRLI--------PDNPAEMALVYQR 102

  Fly    75 -FRT-NFEATHPPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLMLV 137
             |.| |.:.....:...:.| :.|.|::|..:.:|                 .|.|..:|||.  
Zfish   103 MFETENLQQKMYEVAFYDWL-VPEGERLESALKRN-----------------KEKLIEELKLW-- 147

  Fly   138 KKDEAKNNALLSHLRKI--NDHLSARNTRFLTGDTMCCFDCELMPRLQ 183
                      ..:|.|:  ..:|:.:|  |...|.:|.......||||
Zfish   148 ----------EGYLEKMGKGSYLAGKN--FSMADVVCFPVIAYFPRLQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 17/103 (17%)
O-ClC 21..231 CDD:129941 33/178 (19%)
GST_C_CLIC 118..232 CDD:198307 16/68 (24%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 33/178 (19%)
GST_N_family 5..78 CDD:238319 5/31 (16%)
GST_C_family 99..199 CDD:198286 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.