DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstD8

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:173 Identity:40/173 - (23%)
Similarity:72/173 - (41%) Gaps:29/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CQEYFMDLYLL-AELKTISLKVTTVDMQKPPPDFRTNFEATHP----PILIDNGLAILENEKIER 102
            |:...|....| .:|....|||...:..||      .|...:|    |.|:|:|.:|.|:..|..
  Fly    12 CRSVIMTAKALGVDLNMKLLKVMDGEQLKP------EFVKLNPQHCIPTLVDDGFSIWESRAILI 70

  Fly   103 HIMKNIPGGYNLFVQD-KEVATLIENLYVKLKLMLVKKDEA-----KNN--ALLSHLRKIND--- 156
            ::::......:|:..| ::.|.:.:.||..:..:.....||     :||  |....::|::.   
  Fly    71 YLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFG 135

  Fly   157 HLSA--RNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEI 197
            ||..  .:..::.||.:...|..|:..:....|     |||:|
  Fly   136 HLDTFLEDQEYVAGDCLTIADIALLASVSTFEV-----VDFDI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 18/73 (25%)
O-ClC 21..231 CDD:129941 40/173 (23%)
GST_C_CLIC 118..232 CDD:198307 21/93 (23%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 40/173 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/67 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.