DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstD6

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:184 Identity:39/184 - (21%)
Similarity:69/184 - (37%) Gaps:45/184 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MDLY----------LLAELKTI-----SLKVTT-VDMQKPPPDFRTNFEATHPPILIDNGLAILE 96
            ||||          ::...|.:     |::|.| |..|..|...:.|.:.| .|.|:||...|.|
  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHT-IPTLVDNLFVIWE 64

  Fly    97 NEKIERHIMKNIPGGYNLFVQDKEVATLI-ENLYVKL------------KLMLVKKDEAKNNALL 148
            ...|..::::......:|:.:|.:...|| :.||..:            .|:...|...:.|   
  Fly    65 TRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQEN--- 126

  Fly   149 SHLRKINDHLSARNT-----RFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEI 197
              |.|:|......|.     .::.|:.:...|..::     ..|:....|||::
  Fly   127 --LEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVIL-----ATVSTTEMVDFDL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 20/79 (25%)
O-ClC 21..231 CDD:129941 39/184 (21%)
GST_C_CLIC 118..232 CDD:198307 18/98 (18%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 20/73 (27%)
PLN02395 11..208 CDD:166036 35/174 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 17/96 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.