DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and clic5

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_012825763.1 Gene:clic5 / 448566 XenbaseID:XB-GENE-945566 Length:384 Species:Xenopus tropicalis


Alignment Length:248 Identity:74/248 - (29%)
Similarity:122/248 - (49%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEVESQQSQETNGSSKFDVPEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTV 66
            ::.|.....||      :.|:|.:.|||.: ||...|.|.|.|..||.|:    ||.:...||||
 Frog   135 TQYEDAVDNET------EEPDIAIYIKAGS-DGESIGNCPFSQRLFMILW----LKGVVFNVTTV 188

  Fly    67 DMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKNI-PGGY-NLFVQDKEVATLIENLY 129
            |:::.|.|.......||||.|..||....:..|||..:.::: |..| .|..:.:|..|...:::
 Frog   189 DLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEESLAPPRYPKLAAKHRESNTAGIDIF 253

  Fly   130 VKLKLMLVKKDEAKNNA-----LLSHLRKINDHLSA-------RNTR---------FLTGDTMCC 173
            .|.. ..:|..:.::||     |...|:|::.:|::       .|:|         ||.||....
 Frog   254 SKFS-AYIKNTKQQDNAGLEKGLTKALKKLDTYLNSPLPEEIDANSREEEKVSKRKFLDGDEFTL 317

  Fly   174 FDCELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQD 226
            .||.|:|:|..:::..|.:.::|||..::.:|||:.:.|..|.||.:|.||::
 Frog   318 ADCNLLPKLHVVKIVAKKYRNYEIPAEMSGIWRYLKNAYARDEFTNTCAADKE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 34/94 (36%)
O-ClC 21..231 CDD:129941 71/229 (31%)
GST_C_CLIC 118..232 CDD:198307 35/130 (27%)
clic5XP_012825763.1 O-ClC 148..383 CDD:129941 71/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H987
Inparanoid 1 1.050 108 1.000 Inparanoid score I4764
OMA 1 1.010 - - QHG57946
OrthoDB 1 1.010 - - D541338at33208
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm48288
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2518
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.