DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and eEF1gamma

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:190 Identity:38/190 - (20%)
Similarity:75/190 - (39%) Gaps:42/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FEATHPPILID-NGLA-ILENEKIERHIMKNIPGGYNLFVQ----------DKE-VATLIENLYV 130
            ||......|.: |.:| :|.||::.        ||...|||          |.| |......::.
  Fly    58 FETAEGQYLSESNAIAYLLANEQLR--------GGKCPFVQAQVQQWISFADNEIVPASCAWVFP 114

  Fly   131 KLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDF 195
            .|.::..:|:........:.|:::|..|  ::..||.|:.:...|..:...|.|:.   :|.::.
  Fly   115 LLGILPQQKNSTAKQEAEAVLQQLNQKL--QDATFLAGERITLADIVVFSSLLHLY---EYVLEP 174

  Fly   196 EIPTHLTALWRY---MYHMYQLDAFTQSCPADQDIINHYKLQQSLKM---KKHEELETPT 249
            .:.:....:.|:   :.:..|:.|          ::..|||.:...:   ||:.|.:..|
  Fly   175 SVRSAFGNVNRWFVTILNQKQVQA----------VVKDYKLCEKALVFDPKKYAEFQAKT 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 9/34 (26%)
O-ClC 21..231 CDD:129941 31/167 (19%)
GST_C_CLIC 118..232 CDD:198307 18/117 (15%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 6/20 (30%)
GstA 5..187 CDD:223698 29/141 (21%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 22/133 (17%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.