DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and gsto1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:176 Identity:33/176 - (18%)
Similarity:66/176 - (37%) Gaps:33/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPIL-IDNGLAILEN------ 97
            |.|.|.    ..|:...|.|......::::..|..|.........|:| ..:|..|.|:      
Zfish    31 CPFAQR----TRLVLNAKGIKYDTININLKNKPDWFLEKNPLGLVPVLETQSGQVIYESPITCEY 91

  Fly    98 ------EKIERHIMKNIPGGYNLFVQDK-----EVATLIENLYVKLKLMLVKKDE--AKNNALLS 149
                  ||      |.:|  ::.|.:.:     |:.:.:...:.|:.:...|.::  |....|..
Zfish    92 LDEVYPEK------KLLP--FDPFERAQQRMLLELFSKVTPYFYKIPVNRTKGEDVSALETELKD 148

  Fly   150 HLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAG-KYFVD 194
            .|.:.|:.|..:.::|..||::...|..:.|..:.:.... |:.:|
Zfish   149 KLSQFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 17/84 (20%)
O-ClC 21..231 CDD:129941 33/176 (19%)
GST_C_CLIC 118..232 CDD:198307 15/85 (18%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 13/65 (20%)
GstA 25..210 CDD:223698 33/176 (19%)
GST_C_Omega 107..229 CDD:198293 16/88 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.