DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstD1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:167 Identity:36/167 - (21%)
Similarity:66/167 - (39%) Gaps:38/167 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ISLKVTTVDMQKP----------PPDF-RTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGY 112
            ::.|...|::.|.          .|:| :.|.:.| .|.|:|||.|:.|:..|:.::::......
  Fly    18 MTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHT-IPTLVDNGFALWESRAIQVYLVEKYGKTD 81

  Fly   113 NLFVQ-DKEVATLIENLYVKLKLM-----------LVKKDEAKNNALLSHLRKINDHLSARNT-- 163
            :|:.: .|:.|.:.:.||..:..:           :..|..|...|    .:||.......||  
  Fly    82 SLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEA----FKKIEAAFEFLNTFL 142

  Fly   164 ---RFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEI 197
               .:..||::...|..|:..:....||     .|||
  Fly   143 EGQDYAAGDSLTVADIALVATVSTFEVA-----KFEI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 15/63 (24%)
O-ClC 21..231 CDD:129941 36/167 (22%)
GST_C_CLIC 118..232 CDD:198307 20/96 (21%)
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/57 (26%)
GstA 4..185 CDD:223698 36/167 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 20/95 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.