DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstD1

DIOPT Version :10

Sequence 1:NP_572928.1 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:122 Identity:26/122 - (21%)
Similarity:42/122 - (34%) Gaps:45/122 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 LSDTSNFLVVFNSSVNCIIYFIF----NTDYRDVFLIYWKKL-----------------KRVLIE 349
            :|| .|..:.|...:....:|::    ||:|...|||::..|                 .|.|::
  Fly     1 MSD-GNRRICFFDFLRFFGFFVWKIMQNTNYISCFLIFFSHLLLIKCGTGSIVQKCLDGPRPLLD 64

  Fly   350 E---------------YC---CCCVPAGSRNYSAYQPVSTRLVIEKSQNGSSSTKLI 388
            |               :|   .||     .|.:|...::......|...||.|||.:
  Fly    65 ENLSIFSCQRGCPDTFFCENQLCC-----PNTTAISSLNRPAAAGKPNLGSRSTKAV 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_572928.1 GST_N_CLIC 18..112 CDD:239359
GST_C_CLIC 118..232 CDD:198307
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/73 (21%)
GST_C_Delta_Epsilon 89..205 CDD:198287 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.