DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstD9

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:181 Identity:38/181 - (20%)
Similarity:74/181 - (40%) Gaps:41/181 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YFM-------DLYLLAELKTISLKVTTVDM---QKPPPDF-RTNFEATHPPILIDNGLAILENEK 99
            |:|       .:.:.|....:.|....||:   :...|:| :.|.:.| .|.|:|:|.||.|:..
  Fly     5 YYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHT-IPTLVDDGFAIWESRA 68

  Fly   100 IERHIMKNIPGGYNLFVQD-KEVATLIENLYVKLKLML--------------VKKDEAKNNALLS 149
            |..::.:......:|:.:| ::.|.:.:.|:..|..:.              |||....:|    
  Fly    69 ILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDN---- 129

  Fly   150 HLRKINDHLSARNT-----RFLTGDTMCCFDCELMPRLQHIRVA----GKY 191
             |:||:|..:..||     ::...:.:...|..|:..:....::    |||
  Fly   130 -LKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 18/76 (24%)
O-ClC 21..231 CDD:129941 38/181 (21%)
GST_C_CLIC 118..232 CDD:198307 19/98 (19%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 18/70 (26%)
GstA 4..187 CDD:223698 38/181 (21%)
GST_C_Delta_Epsilon 89..207 CDD:198287 18/96 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.