DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and gstt2

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:202 Identity:47/202 - (23%)
Similarity:73/202 - (36%) Gaps:48/202 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QKPPPDFRTNFEATHP----PILIDNGLAILENEKIERHIMK--NIPGGYNLFVQDKEV------ 121
            ||.|     .|...:|    |:|.|||..:.|::.|.:::..  .:|..:...:.:|..      
Zfish    44 QKTP-----EFTKLNPMQKVPVLEDNGFVLTESDAILKYLATTYKVPDHWYPKLPEKRARVDEYT 103

  Fly   122 ----------ATLIENLYVKLKLMLVK-KDEAKNNALLSHLRKINDHLS---ARNTRFLTGDTMC 172
                      |..:....|.|.||..: .:.||....||.|....|.|.   .:...||.||.:.
Zfish   104 AWHHMNTRMHAATVFWQEVLLPLMTGQPANTAKLEKALSDLSGTLDKLENMFLKRQAFLCGDDIS 168

  Fly   173 CFD----CELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHYKL 233
            ..|    ||||..:...|...|     :.|..|:  ||........|:|.::    ..|:  |:|
Zfish   169 LADLLAICELMQPMSSGRDILK-----DRPKLLS--WRSRVQSALSDSFDEA----HTIV--YRL 220

  Fly   234 QQSLKMK 240
            :.....|
Zfish   221 RDKFTAK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 13/48 (27%)
O-ClC 21..231 CDD:129941 44/191 (23%)
GST_C_CLIC 118..232 CDD:198307 31/137 (23%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 12/42 (29%)
GST_C_Theta 95..220 CDD:198292 32/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.