DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstO1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:205 Identity:43/205 - (20%)
Similarity:69/205 - (33%) Gaps:65/205 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMK 106
            || .|...::|:.:.|.|......::::..|..|.....:|..|.|          |.::..   
  Fly    29 FC-PYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPAL----------ELVKEQ--- 79

  Fly   107 NIPGGYNLFVQDKEVATLIENLYVKLKLM---LVKKDEAK---------NNA---LLSH------ 150
                |..:.::...:...::..|.::.|.   |:||.:.|         .||   ||.|      
  Fly    80 ----GNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQL 140

  Fly   151 --------LRKINDHLSARNTRFLTGDTMCCFD------CELMPRLQHIRVAGKYFVD--FEI-P 198
                    |....:.|..|.|:|..||:....|      ||....|       ||..:  ||: |
  Fly   141 VDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSL-------KYTFEQKFELSP 198

  Fly   199 THLTAL--WR 206
            .....|  ||
  Fly   199 ERFPTLIKWR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 12/69 (17%)
O-ClC 21..231 CDD:129941 43/205 (21%)
GST_C_CLIC 118..232 CDD:198307 30/129 (23%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 13/83 (16%)
GstA 22..216 CDD:223698 43/205 (21%)
GST_C_Omega 109..234 CDD:198293 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.