DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstO2

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:272 Identity:57/272 - (20%)
Similarity:91/272 - (33%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QSQETNGSSKFDVPEIELIIKASTIDG-RRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKP 71
            |.....||:|.::||          || .|..:..|| .:...:.|:...|.|......||:.:.
  Fly     5 QKHFKRGSTKPELPE----------DGVPRFFSMAFC-PFSHRVRLMLAAKHIEHHKIYVDLIEK 58

  Fly    72 PPDFRTNFEATHPPILIDNGL----AILENEKIERHIMKNIPGGYNLFVQD-----------KEV 121
            |..::........|.|...|:    .::|:..|..::.:..| ...||..|           :..
  Fly    59 PEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYLDQQYP-QTRLFPTDPLQKALDKILIERF 122

  Fly   122 ATLIENLYVKLKL-MLVKKDEAKN--NALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQ 183
            |.::..:|..|.. ....||...|  ||    |......|..|.|.:..|..:...|..:.|..:
  Fly   123 APVVSAIYPVLTCNPNAPKDAIPNFENA----LDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFE 183

  Fly   184 H-----IRVAGKYFVD---FEIPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHYKLQQSL--K 238
            .     |....||.:|   ||    ....||        |..||     .:::....|...|  :
  Fly   184 RFPSMKINTEQKYELDTKRFE----KLLKWR--------DLMTQ-----DEVVQKTALDVQLHAE 231

  Fly   239 MKKHEELETPTF 250
            .:|.:.|..|.:
  Fly   232 FQKSKTLGNPQY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 19/98 (19%)
O-ClC 21..231 CDD:129941 48/236 (20%)
GST_C_CLIC 118..232 CDD:198307 27/135 (20%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 22/101 (22%)
GstA 25..215 CDD:223698 41/207 (20%)
GST_C_Omega 110..235 CDD:198293 28/145 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.