DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and se

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:189 Identity:46/189 - (24%)
Similarity:68/189 - (35%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GSSKFDVPEIELIIKASTIDG-RRKGACLFCQEYFMDLYLLAELKTI---SLKVTTVD-----MQ 69
            ||...||||          || .|..:..|| .:...::|:.:.|.|   |:.:...|     ::
  Fly    10 GSPMPDVPE----------DGILRLYSMRFC-PFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLE 63

  Fly    70 KPPPDFRTNFEATH---PPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVK 131
            |.|.......|...   ||:|.:: |.|.|....:..:....|......||||   .|||.....
  Fly    64 KNPQGKVPALEIVREPGPPVLTES-LLICEYLDEQYPLRPLYPRDPLKKVQDK---LLIERFRAV 124

  Fly   132 LKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMP---RLQHIRV 187
            |.......|........|.|......|:.|.|.|..|:.....|..:.|   ||:.:::
  Fly   125 LGAFFKASDGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 24/105 (23%)
O-ClC 21..231 CDD:129941 42/182 (23%)
GST_C_CLIC 118..232 CDD:198307 18/73 (25%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 25/96 (26%)
GstA 22..215 CDD:223698 38/167 (23%)
GST_C_Omega 109..229 CDD:198293 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.