DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and Gdap1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_647945.1 Gene:Gdap1 / 38597 FlyBaseID:FBgn0035587 Length:327 Species:Drosophila melanogaster


Alignment Length:263 Identity:54/263 - (20%)
Similarity:101/263 - (38%) Gaps:67/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NGSSKFDVPEIE---LIIKAST-----IDGRRKG-----ACLFCQEYFMDLYLLAELKTISLKVT 64
            |.:.|.|||.::   |:|.:||     ::.:.:|     .....:|:  |..|:.|.....|.|.
  Fly    72 NLNPKGDVPVLQDGALVIPSSTHIINYVESKFRGDRSLKPAHNSKEF--DQMLIFEQAMARLPVG 134

  Fly    65 TV--------DMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEV 121
            |:        |::..|   :..|........:.|...:|:   :.||.:             .|.
  Fly   135 TLSLGSFIHDDLKLVP---KAPFIGPVRQSCLKNNEKVLD---LLRHSV-------------DEQ 180

  Fly   122 ATLIENLYVKLKLMLVKKDEAKN--------NALLSHLRKINDHLSARNTR--FLTGDTMCCFDC 176
            ||....|..||.:.|.:.:.|.:        :|:...|..:...|:|:..|  :||||.:...|.
  Fly   181 ATKKAALQHKLDIQLRRHELASSREEFQKVLDAVRHFLLYVEQELTAQAPRVEWLTGDELSVADI 245

  Fly   177 E---LMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDII--------NH 230
            .   |:.||..:....:::...::|    .:..|.....|.::|.:..|::..|:        .:
  Fly   246 SLGLLLHRLYQLGFENQFWTFGKLP----QVEAYFLRFRQRESFHRLQPSNFAILREMWTRTPGN 306

  Fly   231 YKL 233
            |||
  Fly   307 YKL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 22/114 (19%)
O-ClC 21..231 CDD:129941 47/251 (19%)
GST_C_CLIC 118..232 CDD:198307 27/134 (20%)
Gdap1NP_647945.1 GST_N_family 28..100 CDD:238319 9/27 (33%)
GstA 30..290 CDD:223698 49/242 (20%)
GST_C_family 178..285 CDD:295467 24/110 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.