Sequence 1: | NP_001259537.2 | Gene: | Clic / 32349 | FlyBaseID: | FBgn0030529 | Length: | 260 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246500.1 | Gene: | GstE12 / 37960 | FlyBaseID: | FBgn0027590 | Length: | 223 | Species: | Drosophila melanogaster |
Alignment Length: | 147 | Identity: | 33/147 - (22%) |
---|---|---|---|
Similarity: | 54/147 - (36%) | Gaps: | 40/147 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 YFMDLYLLAELKTISLKVTTVDMQKPP----------PDF-RTNFEATHPPILIDNGLAILENEK 99
Fly 100 IERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLMLVKKDEAKNNALLSHLRKINDHLSARNTR 164
Fly 165 FL------TGDTMCCFD 175 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Clic | NP_001259537.2 | GST_N_CLIC | 18..112 | CDD:239359 | 15/76 (20%) |
O-ClC | 21..231 | CDD:129941 | 33/147 (22%) | ||
GST_C_CLIC | 118..232 | CDD:198307 | 18/64 (28%) | ||
GstE12 | NP_001246500.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 17/90 (19%) |
GstA | 6..201 | CDD:223698 | 33/147 (22%) | ||
GST_C_Delta_Epsilon | 92..210 | CDD:198287 | 12/40 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45460394 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |