DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstE11

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:150 Identity:34/150 - (22%)
Similarity:54/150 - (36%) Gaps:48/150 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLMLVKKDEAKNNALLS 149
            |:|.|||..:.::     ||:.:       ::.||......::||        .||..|...:  
  Fly    57 PVLDDNGTIVSDS-----HIICS-------YLADKYAPEGDDSLY--------PKDPEKRRLV-- 99

  Fly   150 HLRKINDHLSARNTRFLTGDTMCCFDC-ELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQ 213
                               |....:|| .|.||::.|.....||...|:|:...|   |:...| 
  Fly   100 -------------------DARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVA---YLQKAY- 141

  Fly   214 LDAFTQSCPADQDIINHYKL 233
             |.. :.|.|:.|.:...||
  Fly   142 -DGL-EHCLAEGDYLVGDKL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 7/26 (27%)
O-ClC 21..231 CDD:129941 32/146 (22%)
GST_C_CLIC 118..232 CDD:198307 25/114 (22%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 33/149 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 7/32 (22%)
GST_C_Delta_Epsilon 94..211 CDD:198287 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.