powered by:
Protein Alignment Clic and GstE6
DIOPT Version :9
Sequence 1: | NP_001259537.2 |
Gene: | Clic / 32349 |
FlyBaseID: | FBgn0030529 |
Length: | 260 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611328.1 |
Gene: | GstE6 / 37111 |
FlyBaseID: | FBgn0063494 |
Length: | 222 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 17/70 - (24%) |
Similarity: | 30/70 - (42%) |
Gaps: | 6/70 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 LAELKTISLKVTTVDM----QKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYN 113
||.| .::.:...||: |..|.....|.:.| .|.|.|:|..|.::..|..:::........
Fly 22 LAAL-NLTYEYVNVDIVARAQLSPEYLEKNPQHT-VPTLEDDGHYIWDSHAIIAYLVSKYADSDA 84
Fly 114 LFVQD 118
|:.:|
Fly 85 LYPKD 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45460393 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.