DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstE6

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:70 Identity:17/70 - (24%)
Similarity:30/70 - (42%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LAELKTISLKVTTVDM----QKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYN 113
            ||.| .::.:...||:    |..|.....|.:.| .|.|.|:|..|.::..|..:::........
  Fly    22 LAAL-NLTYEYVNVDIVARAQLSPEYLEKNPQHT-VPTLEDDGHYIWDSHAIIAYLVSKYADSDA 84

  Fly   114 LFVQD 118
            |:.:|
  Fly    85 LYPKD 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 15/62 (24%)
O-ClC 21..231 CDD:129941 17/70 (24%)
GST_C_CLIC 118..232 CDD:198307 1/1 (100%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 17/70 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 15/56 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.