DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GstE2

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:172 Identity:33/172 - (19%)
Similarity:60/172 - (34%) Gaps:49/172 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPILI 88
            :|.::|..:|...|...|...::|.|.:|                 |..|....       |:|.
  Fly    20 KLTLRALNLDYEYKEMDLLAGDHFKDAFL-----------------KKNPQHTV-------PLLE 60

  Fly    89 DNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIEN--------LYVKLK----------LM 135
            |||..|.::..|..:::........|:.:|..:...::.        |::.|:          :.
  Fly    61 DNGALIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVS 125

  Fly   136 LVKKDEAKN-NALLSHLRKI---NDHLSARNTRFLTGDTMCC 173
            ||.|::..| .....||...   |.:|:...   ||...:||
  Fly   126 LVPKEKVDNIKDAYGHLENFLGDNPYLTGSQ---LTIADLCC 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 17/87 (20%)
O-ClC 21..231 CDD:129941 33/172 (19%)
GST_C_CLIC 118..232 CDD:198307 15/78 (19%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 33/172 (19%)
GST_N_Delta_Epsilon 5..78 CDD:239343 17/81 (21%)
GST_C_Delta_Epsilon 94..209 CDD:198287 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.