DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and Gdap1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001101367.1 Gene:Gdap1 / 312890 RGDID:1309005 Length:358 Species:Rattus norvegicus


Alignment Length:141 Identity:27/141 - (19%)
Similarity:48/141 - (34%) Gaps:33/141 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PPDFRTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATL------IENLYV 130
            |.|..|:....||.:.:|:.:......:|...|...          :.|:..|      ::..|:
  Rat   132 PMDAYTHGCILHPELTVDSMIPAYATTRIRGQIGNT----------ESELKKLAEENPDLQEAYI 186

  Fly   131 ----KLKLMLVKKDEAKN-NALLSHLRKINDHLSAR------------NTRFLTGDTMCCFDCEL 178
                :||..|:..|..|. ..:|..|.|:.|.:...            |..:|.|::....|..|
  Rat   187 AKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPDEGNQPWLCGESFTLADVSL 251

  Fly   179 MPRLQHIRVAG 189
            ...|..::..|
  Rat   252 AVTLHRLKFLG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 8/39 (21%)
O-ClC 21..231 CDD:129941 27/141 (19%)
GST_C_CLIC 118..232 CDD:198307 19/95 (20%)
Gdap1NP_001101367.1 GstA 26..292 CDD:223698 27/141 (19%)
GST_N_GDAP1 26..98 CDD:239350
GST_C_GDAP1 179..289 CDD:198336 17/84 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.