DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and Clic6

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:234 Identity:77/234 - (32%)
Similarity:117/234 - (50%) Gaps:31/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPI 86
            :|.|.:||.: ||...|.|.|.|..||.|:    ||.:...|||||:::.|.|.:.....|:||.
  Rat   379 DITLFVKAGS-DGESIGNCPFSQRLFMILW----LKGVIFNVTTVDLKRKPADLQNLAPGTNPPF 438

  Fly    87 LIDNGLAILENEKIERHI-MKNIPGGY-NLFVQDKEVATLIENLYVKLKLML--VKKDE----AK 143
            :..:|....:..|||..: .|.:|..| .|..|..|..:...:::.|....:  .|||.    .|
  Rat   439 MTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANDIYEK 503

  Fly   144 NNALLSHLRKIN--------DHLSARNT--------RFLTGDTMCCFDCELMPRLQHIRVAGKYF 192
            |  ||..|:|::        |.:.|.:|        :||.||.:...||.|:|:|..|::..|.:
  Rat   504 N--LLRALKKLDSYLNSPLPDEIDAYSTEDVTVSQRKFLDGDELTLADCNLLPKLHIIKIVAKKY 566

  Fly   193 VDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHY 231
            ..||.|:.:|.:|||:.:.|..|.||.:|||||:|.:.|
  Rat   567 RGFEFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAY 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 31/90 (34%)
O-ClC 21..231 CDD:129941 76/232 (33%)
GST_C_CLIC 118..232 CDD:198307 43/136 (32%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 77/233 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D541338at33208
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm45221
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.