DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and Clic4

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:242 Identity:76/242 - (31%)
Similarity:120/242 - (49%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SQETNGSSKFD-VPEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPP 72
            |...||..:.| .|.|||.:||.: ||...|.|.|.|..||.|:    ||.:...|||||:::.|
Mouse     4 SMPLNGLKEEDKEPLIELFVKAGS-DGESIGNCPFSQRLFMILW----LKGVVFSVTTVDLKRKP 63

  Fly    73 PDFRTNFEATHPPILIDNGLAILENEKIERHIMKNI--PGGYNLFVQDKEVATLIENLYVK---- 131
            .|.:.....||||.:..|.....:..|||..:.:.:  |....|..:..|..|...:::.|    
Mouse    64 ADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAY 128

  Fly   132 LKLMLVKKDEAKNNALLSHLRKINDHLSA----------------RNTRFLTGDTMCCFDCELMP 180
            :|....:.:||....||..|:|::::|::                ...|||.||.|...||.|:|
Mouse   129 IKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRRFLDGDEMTLADCNLLP 193

  Fly   181 RLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDI 227
            :|..::|..|.:.:|:||..:|.:|||:.:.|..|.||.:||:|:::
Mouse   194 KLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 34/96 (35%)
O-ClC 21..231 CDD:129941 72/229 (31%)
GST_C_CLIC 118..232 CDD:198307 38/130 (29%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 36/101 (36%)
O-ClC 17..252 CDD:129941 72/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4746
Isobase 1 0.950 - 0 Normalized mean entropy S6054
OMA 1 1.010 - - QHG57946
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm43152
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.950

Return to query results.
Submit another query.