DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GSTT1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:198 Identity:40/198 - (20%)
Similarity:70/198 - (35%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EYFMDL--------YLLAELKTISLKVTTVDMQKPPPDFRTNFEATHP----PILIDNGLAILEN 97
            |.::||        |:.|:...|..::..||:.| .......|...:|    |.|.|....:.|:
Human     4 ELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIK-GQHLSDAFAQVNPLKKVPALKDGDFTLTES 67

  Fly    98 EKIERHIMK--NIPGGYNLFVQDKEVATLIEN----------------LYVKLKLMLVKKDEAKN 144
            ..|..::.:  .:|..:  :.||.:....::.                |:.|:...:...:....
Human    68 VAILLYLTRKYKVPDYW--YPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSP 130

  Fly   145 NALLSHLRKINDHLS------ARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTA 203
            ..|.:.|.:::..|.      .:|..||||..:...|...:..|.|...||...  ||....| |
Human   131 QTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQV--FEGRPKL-A 192

  Fly   204 LWR 206
            .||
Human   193 TWR 195

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 17/80 (21%)
O-ClC 21..231 CDD:129941 40/198 (20%)
GST_C_CLIC 118..232 CDD:198307 22/111 (20%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 16/74 (22%)